SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005541133.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005541133.1.63531
Domain Number 1 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-47
Family SPRY domain 0.0000366
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 5.42e-21
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.97e-17
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  XP_005541133.1.63531
Domain Number - Region: 150-244
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.085
Family MukF C-terminal domain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005541133.1.63531
Sequence length 477
Comment PREDICTED: E3 ubiquitin-protein ligase TRIM17 isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MEAVELARKLQEEATCSICLDYFTDPVMTACGHNFCRACIQLSWEKARGKKGRRKRKGSF
PCPECRAMSPQRNLLPNRLLTKVAEMARQHPGLQKQDLCQEHQEPLKLFCQEDQSPICVV
CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
RRERIVLEFEKMNLYLLEEEQRLLQALEREEEETASRLRESVDCLDRQGHSLELLLLQLE
ERSTHGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD
ATSAYPYLLLYESRQRRYLSSSLEGSRFCSKDRFMAYPCAVGQTTFSSGRHYWEVGMNIT
GDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTLSAPIPVMLMEPPSHVGV
FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG
Download sequence
Identical sequences A0A2K6C8A4 F7GJW5 G8F2Y8
XP_001082856.1.72884 XP_005541133.1.63531 XP_005541134.1.63531 XP_011770742.1.29376 XP_014970187.1.72884 XP_014970192.1.72884 XP_015306432.1.63531 9544.ENSMMUP00000007023 ENSMMUP00000007023 ENSMMUP00000007023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]