SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005543468.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005543468.1.63531
Domain Number 1 Region: 6-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.78e-52
Family Ankyrin repeat 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005543468.1.63531
Sequence length 168
Comment PREDICTED: cyclin-dependent kinase 4 inhibitor C [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Download sequence
Identical sequences A0A0D9S7B4 A0A2I3M0Q8 A0A2K5KBM1 A0A2K5L989 A0A2K5ZQJ3 A0A2K6BUQ3 F6QTJ3 G3RLG5 G8F3B6 H2N7G0 H2PZ05 P42773 Q6ICV4
ENSPANP00000010291 NP_001253.1.87134 NP_001253.1.92137 NP_001253243.1.72884 NP_523240.1.87134 NP_523240.1.92137 XP_002810883.1.23681 XP_004025825.1.27298 XP_005543468.1.63531 XP_007976975.1.81039 XP_008953192.1.60992 XP_009248768.1.23681 XP_009455846.1.37143 XP_011762464.1.29376 XP_011781637.1.43180 XP_011829116.1.47321 XP_011884918.1.92194 XP_014200658.1.60992 XP_014994666.1.72884 XP_018873794.1.27298 XP_524704.2.37143 001204225|e1bu9A2|109.3.1.2|A:1-168 cath|current|1bu9A00/1-168 cath|current|1g3nB00/6-160 cath|current|1g3nF00/6-160 d1bu9a_ ENSPPYP00000001587 ENSPTRP00000001246 1g3nB ENSGGOP00000016612 ENSGGOP00000016612 ENSPPYP00000001587 ENSP00000262662 ENSP00000360826 ENSP00000379452 ENSMMUP00000025054 ENSP00000262662 ENSP00000360826 ENSP00000379452 1bu9_A 1g3n_B 1g3n_F gi|17981699|ref|NP_523240.1| gi|4502751|ref|NP_001253.1| 9544.ENSMMUP00000025054 9598.ENSPTRP00000001246 9600.ENSPPYP00000001587 9606.ENSP00000262662 ENSPTRP00000001246 ENSMMUP00000025054 ENSP00000262662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]