SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005546899.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005546899.1.63531
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-36
Family SCAN domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 211-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000184
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005546899.1.63531
Sequence length 1029
Comment PREDICTED: zinc finger protein 197 isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MTRENWAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALVEEL
QKDLDGPAIQVPVLVQDQDTLQKAVSAPGTTLPPVLPGSHIAAEICPHPPTDLVAFNLQD
PQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEE
CEWQVLASQWGNETDERADTVKKGSLCERDKKKRTPPEKQGQKWKEFGDSLTFSSAISET
LIGTEGKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLIDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFSSKSNFLDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECQECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECGECGRAFSSNRNLIEH
KRIHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH
TGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECLICRKVLTSSRNLMVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKIHTDEKPCECDVSEKEFCQTSSIHLQQKIHTIEELSWLQNTH
ESKIEIQKI
Download sequence
Identical sequences A0A096NDF2 A0A2K5L4M7 A0A2K5ZXT3 G7MIW1 G8F2T8
XP_005546899.1.63531 XP_011836511.1.47321 XP_011888661.1.92194 XP_011888662.1.92194 XP_011888663.1.92194 XP_011888665.1.92194 XP_011888666.1.92194 XP_011888667.1.92194 XP_015301233.1.63531 XP_015301234.1.63531 XP_015301235.1.63531 ENSPANP00000010896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]