SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005548710.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005548710.1.63531
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily ISP domain 0.0641
Family Rieske iron-sulfur protein (ISP) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005548710.1.63531
Sequence length 235
Comment PREDICTED: protein FAM3B isoform X2 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MRPLVSGPLKVVFLVLASLCAWYSGYLLAELIPDAPLSSAAYSIHSIGERPVLKAPVPKR
QKCDHWTPCPSDTYAYRLLSGGGINKYAKICFEDDLLMGEKLGNVARGINIAIVNYVTGN
VTATQHFDMYEGDNSGPMIKFIQSAPPKSLLFMVTYDDGSTRLNNDAKNAIEELGSKEIR
NMKFRSSWVFLAAKGFELPSEIQREKINHSDTKNNRYSGWPAEIQIEGCIPKEPS
Download sequence
Identical sequences A0A096NIY2 A0A2K5X134 A0A2K6CSB9 H9ZA89
ENSMMUP00000005689 ENSPANP00000012930 XP_005548710.1.63531 XP_011724297.1.29376 XP_014988334.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]