SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005551810.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005551810.1.63531
Domain Number 1 Region: 75-181
Classification Level Classification E-value
Superfamily WWE domain 4.71e-33
Family WWE domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 35-80
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000683
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005551810.1.63531
Sequence length 359
Comment PREDICTED: E3 ubiquitin-protein ligase RNF146 isoform X2 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCV
KGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERT
SRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGL
RLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRPLTSVDGQLTSPATPSPDAST
SLEDSFAHLQLSGDSIAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSENVSS
AVVAQHSLTQQRLLVSNANQTVSDRSDQSGTDRSVAGGGTVSVSVRSRRPDGQCTVTEV
Download sequence
Identical sequences F7GUD1 G7P376
NP_001253516.1.72884 XP_005551806.1.63531 XP_005551807.1.63531 XP_005551808.1.63531 XP_005551809.1.63531 XP_005551810.1.63531 XP_011712340.1.29376 XP_011712341.1.29376 XP_011712342.1.29376 XP_011712343.1.29376 XP_011712344.1.29376 XP_011848472.1.47321 XP_011848473.1.47321 XP_011848474.1.47321 XP_011848475.1.47321 XP_011848476.1.47321 XP_014992782.1.72884 XP_014992783.1.72884 XP_014992784.1.72884 XP_014992785.1.72884 XP_015303877.1.63531 ENSMMUP00000033088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]