SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005556177.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005556177.1.63531
Domain Number 1 Region: 226-487
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.03e-97
Family Fibrinogen C-terminal domain-like 0.0000000000661
Further Details:      
 
Domain Number 2 Region: 88-224
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 4.28e-65
Family Fibrinogen coiled-coil and central regions 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005556177.1.63531
Sequence length 491
Comment PREDICTED: fibrinogen beta chain [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MKRMVSWSFHKFKTMKHLLLLLLCVFLVKSQGVNGNEESPFSGRGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAASQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRSSVDELKNSVQIVSQTSSSTFQYTYLLKDMWQKRQKQVKDNENVVNEYSSDLEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWNPYK
QGFGNIATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLTGENRTMTIHNGMFFSTYDRDNDGWLTADP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGKYTWDMAKHGTDDGVVWMNWKGSWYSMKKM
SMKIRPFFPQQ
Download sequence
Identical sequences F6UZ87 G7P6F7
9544.ENSMMUP00000028060 ENSMMUP00000028060 XP_005556177.1.63531 XP_014994859.1.72884 ENSMMUP00000028060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]