SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005557680.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005557680.1.63531
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily PX domain 1.74e-24
Family PX domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005557680.1.63531
Sequence length 169
Comment PREDICTED: sorting nexin-24 isoform X2 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPS
KHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDET
ESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLHPR
Download sequence
Identical sequences A0A096MU87 A0A0D9RQ51 A0A2K5K412 A0A2K6D8T2 A0A2K6QTG1 F7BC41
NP_001253340.1.72884 XP_005557680.1.63531 XP_008012441.1.81039 XP_010359711.1.97406 XP_011708404.1.29376 XP_011819101.1.43180 XP_011945454.1.92194 XP_017715230.1.44346 9544.ENSMMUP00000013954 ENSMMUP00000013954 ENSMMUP00000013954 ENSPANP00000003384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]