SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005561641.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005561641.1.63531
Domain Number 1 Region: 111-146
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000144
Family CCCH zinc finger 0.00033
Further Details:      
 
Domain Number 2 Region: 151-183
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000183
Family CCCH zinc finger 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005561641.1.63531
Sequence length 338
Comment PREDICTED: zinc finger protein 36, C3H1 type-like 1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGSGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
Download sequence
Identical sequences A0A096NVR1 A0A0D9RL01 A0A2K5IHR0 A0A2K5PC12 A0A2K5V6D9 A0A2K6QZ47 A0A2K6TEN4 G7MYI0
XP_003924515.1.74449 XP_005561641.1.63531 XP_007985284.1.81039 XP_010333498.1.74449 XP_010358021.1.97406 XP_010358022.1.97406 XP_011805088.1.43180 XP_011805089.1.43180 XP_014999454.1.72884 XP_017356446.1.71028 ENSPANP00000017136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]