SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005562275.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005562275.1.63531
Domain Number 1 Region: 209-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000291
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 2 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000291
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 167-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  XP_005562275.1.63531
Domain Number - Region: 57-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00682
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005562275.1.63531
Sequence length 383
Comment PREDICTED: protein delta homolog 1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MTATEALLRVLLLLLAFGHSTHGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCEEPWQCICTDGWDGKLCDRDVRACSSTPCANNGTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASGPCQNGGTCLQHTQVSYECLCKPEFT
GLTCVKKRALSPQQVTHLPSGYGLTYRLTPGVHELPVPQPEHRVLKVSMKELNKNTPLLT
EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNRMLRKKKNLLLQYNSGEDLA
VNIIFPEKIDMTTFSKEAGGEEI
Download sequence
Identical sequences A0A2K5TMQ6
XP_005562275.1.63531 XP_014999982.1.72884 XP_015309693.1.63531 ENSMMUP00000026358 ENSMMUP00000026357 9544.ENSMMUP00000026357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]