SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005563633.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005563633.1.63531
Domain Number 1 Region: 78-325
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-68
Family Nuclear receptor ligand-binding domain 0.0000000013
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.34e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005563633.1.63531
Sequence length 408
Comment PREDICTED: hepatocyte nuclear factor 4-gamma isoform X2 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDK
RNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVS
SPGSSIDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHL
LLGATKRSMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACL
KAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITW
QMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMS
TLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Download sequence
Identical sequences A0A2K5V5T5
ENSMMUP00000003720 ENSMMUP00000003720 XP_005563633.1.63531 XP_005563634.1.63531 XP_005563635.1.63531 XP_005563636.1.63531 XP_015001083.1.72884 9544.ENSMMUP00000003720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]