SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005563803.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005563803.1.63531
Domain Number - Region: 145-205
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.051
Family Allantoicase repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005563803.1.63531
Sequence length 207
Comment PREDICTED: protein C8orf37 homolog isoform X2 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MAEDLDELLDEVESKFCTPDLLRRGVVDQPKGCDGGTHSSDRNQAEAKENLRSTETFEKE
DDLDSLINEIFEEPNLDKKPSKLKSKSSGNTSVRASIQGLGKSCSPVYLGGSSIPCGIGT
NISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLVKKKGTRAYA
CQCSWRTIEEVTDLQTDHQLRWVCGKH
Download sequence
Identical sequences A0A096NEP7 A0A2K6AFH0 A0A2K6D4K4 G7PC93 H9FQI8
ENSPANP00000011374 9544.ENSMMUP00000021677 NP_001180822.1.72884 XP_005563803.1.63531 XP_011834054.1.47321 ENSMMUP00000021677 ENSMMUP00000021677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]