SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005566287.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005566287.1.63531
Domain Number 1 Region: 170-268
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 50-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000973
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 3 Region: 122-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000648
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005566287.1.63531
Sequence length 302
Comment PREDICTED: kazal-type serine protease inhibitor domain-containing protein 1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MPPPPAAALALSVLLLLLMVRTPLPTGARPSSGPDYLRRGWLRLLAEGEGCAPCRPEECA
APRGCLAGWVRDACGCCWECANLEGQLCDLDPSAHFYGHCGEQLECRLDTGGDLSRGEVP
EPLCACRSQSPLCGSDGHTYAQICRLQEAARARPAANLTVAHPGPCESGPQIVSHPYDTW
NVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQA
VRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPEEETESQESDD
YY
Download sequence
Identical sequences A0A2K6DJF7 G7PDS7
ENSMMUP00000023248 ENSMMUP00000023247 XP_001109857.1.72884 XP_005566287.1.63531 XP_005566288.1.63531 XP_005566290.1.63531 XP_011733904.1.29376 XP_011733905.1.29376 XP_011733906.1.29376 9544.ENSMMUP00000023248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]