SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005577096.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005577096.1.63531
Domain Number 1 Region: 65-252
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.61e-72
Family T-box 0.000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005577096.1.63531
Sequence length 385
Comment PREDICTED: T-box transcription factor TBX10 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MAAFLSAGFGILAPSETYPLPTTSSGWEPQLGSPFPSGPCTSSTGAQAVAESNGQGPKNP
RVSSVTVQLEMKPLWEEFNQLGTEMIVTKAGRRMFPPFQVKILGMDSLADYALLMDFIPL
DDKRYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDD
NGHIILNSMHRYQPRFHVVFVDPRKDSERYAQENFKSFIFTETQFTAVTAYQNHRITQLK
IASNPFAKGFRESDPDSWPVAPQPLLSVPARSHSSLSPCLLKGATERKKDPNKASASTSR
TPARLHHQLLPPSEALLAPATYRPVTYQSLYSGASNHLGIPRTRPAPYPLPNIRADSDQG
GLPLPAGLGLLSPTVVCLGPGQDSQ
Download sequence
Identical sequences A0A2K5UDB5
9544.ENSMMUP00000024379 XP_005577096.1.63531 XP_014969038.1.72884 ENSMMUP00000024379 ENSMMUP00000024379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]