SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005580251.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005580251.1.63531
Domain Number 1 Region: 219-312
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 38-139
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-17
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 127-208
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-17
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005580251.1.63531
Sequence length 345
Comment PREDICTED: opioid-binding protein/cell adhesion molecule isoform X5 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
DRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQVPPQIMNISSDVTVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGF
VSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKG
ILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRMSTLTFFNVSEKDYGNYTCVATN
KLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Download sequence
Identical sequences A0A2I3ME37 A0A2K5P1C9 A0A2K6ANU4 F6WLQ2 G7PPV6
9544.ENSMMUP00000026594 XP_005580251.1.63531 XP_011730140.1.29376 XP_014971633.1.72884 ENSMMUP00000026594 ENSMMUP00000036579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]