SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005594892.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005594892.1.63531
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily GLA-domain 1.43e-21
Family GLA-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005594892.1.63531
Sequence length 231
Comment PREDICTED: transmembrane gamma-carboxyglutamic acid protein 3 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MAVFLEAKDAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFW
KGYPNAVYSVRDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHHPSYAQNRY
LASRAGHTLPRVMVYRGTMHSQGEPSGHREAVSSPQVVVGPSQGGRTTVRLESTLYLPEL
SLSRLSSTTPPPSYEEVTAPQESSSEEASMSYSDPPPKYEEIVAANPGADK
Download sequence
Identical sequences A0A2K5WEU1 F7CHW3
ENSMMUP00000022262 ENSMMUP00000022262 XP_001092489.3.72884 XP_005594892.1.63531 XP_005594893.1.63531 XP_014983912.1.72884 9544.ENSMMUP00000022262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]