SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005600691.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005600691.1.31192
Domain Number 1 Region: 30-518
Classification Level Classification E-value
Superfamily Sema domain 1.83e-180
Family Sema domain 0.0000000000127
Further Details:      
 
Domain Number 2 Region: 515-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000296
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 579-652
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000104
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005600691.1.31192
Sequence length 747
Comment PREDICTED: semaphorin-3B isoform X1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MGRAEAAAMIPSLALLWAAVLGGATPSPPRLRLSFQELQARHGLQTFRLERTCCYEALLV
DEERGRLFVGAENHVASLSLDNISKRVKKLAWPAPVEWREECNWAGKDIGTECMNFVKLL
HAYNRTHLLACGTGAFHPTCGFVEVGHRLEEPMLRLDHRRLEDGKGKSPYDPRHRAASVL
VGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRELAVEATPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLQDVFLLSSRDRWTPLLYAVFSTSSGIFQGSAVCMYSMNDVRRAFLGPFAHKEG
PMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIKFARNHPLMYNSVLPMGGRPL
FLQVGAGYTFTQITADRVAAADGHYDVLFIGTDAGTVLKVISVPKGGWPNAEGLLLEELH
VFEDSAAVTSMQISSKRHQLYIASRSAVAQIPLHRCAAHGHACAECCLARDPYCAWDGAA
CTRFQPSGKRRFRRQDVRNGDPSTLCSGDSSHPTLLEQKVFGVEGGSAFLECEPRSLQAR
VEWTFQRPGEAASTQVPAEERAERTTRGLLLRGLRRGDSGMYLCAAVEQGFSQPLRRLAL
HVLSAAQAERLARTEDAAPVAPLGPKLWYRDFLQLVEPGGGGASSLRMCRPQPGPRPPPP
ELRKKGRNRRTHATETRSERGPRSAAH
Download sequence
Identical sequences F7AP03
9796.ENSECAP00000011856 XP_001916031.1.31192 XP_005600691.1.31192 XP_005600692.1.31192 XP_014587145.1.31192 XP_014587146.1.31192 ENSECAP00000011856 ENSECAP00000011856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]