SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005600822.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005600822.1.31192
Domain Number - Region: 232-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000658
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 
Domain Number - Region: 558-596
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0972
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005600822.1.31192
Sequence length 836
Comment PREDICTED: CUB domain-containing protein 1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MAGLNCGITIALLGVLLLNGALPPLGVEASEIAVPHGSGITVLIKPGTPTLPAKACYIVV
FKKHVTTLSIKSGERTVFSFSCQDPENHFVVEIQKNIDCMSGPCPFGEVQLQPSPSVLPA
LNRTFIWDVKAHKSIGLELQFSKPRLRQIEPGESCPDGVTHSISGRIDTTMVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHDRNISGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PDGFPEDELMTWQFVIPGHLRASVSFLNFNNSNCEKKEERVEYYIPGSTTNPEVFKLEDK
QPGNMAGNFNLSLQGCDQDAQSPGIFRLQFQVLVQHPQNESNKTYVVDLSDERAMSLTIE
PKPIRLSRKFVPACYVCLETWFCNTTLTLTSGSKHKISFLCNDLTRLQMNAEKTISCTDR
RYCHKKSYPLQVPSNILQLPVQLHNFSWKLLVPKDSLSLVLVPVQKLQQHTYERACNTSF
RYLVASAVPSQDLYFGSFCSGGSIEQIQVKQNISVTLRTFSPSYQQDISRQGLTVSFRPY
FTEEAVFTVTPDVKSKVYLRTPNWDRGLPSLASVSWNISVPRDQVACLTFLKERTGLVCQ
TGRAFMIIQEQRMRAEEIFSLEEVLPKPRFHHHSFWVNISNCSPVSGKQLDMLFWVLLSP
RTTDMTVIIIAVVGGGALLMFALGLIICLVKKKKKKEINKGPAVGIYNGNVNTQMPMQSK
KFQKRRKDNDSHVYAVIDDTMVYGHLLQDSNGSFVQPEVDTYRPFQGPTGDCPPSPPPIG
FRAPTAKLTTDEPPPDIPPESESEPYTFSHPNKENVSNGNTDIPLLDAHKPAEPGE
Download sequence
Identical sequences F6SUX5
ENSECAP00000022716 9796.ENSECAP00000022716 XP_005600822.1.31192 ENSECAP00000022716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]