SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005610954.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005610954.1.31192
Domain Number 1 Region: 231-486
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.22e-64
Family Eukaryotic proteases 0.000000106
Further Details:      
 
Domain Number 2 Region: 51-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-20
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 191-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000239
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005610954.1.31192
Sequence length 490
Comment PREDICTED: complement C1r subcomponent-like protein [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MSGSRCLFSEWGNHLWGSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQKLTSPR
YPEPYLKGQESSIDIKAPEGFAVRLVFQDFDLEPSQDCERDSVTITASGMDPSRFCGQQG
SPLGSPPGQKEFVSSSSLRLTFRAPASSEDRTTHLHKGFLALYQAVGMNHSRPMSQANGG
SEATHTPGDNPSKIQNHCQEPYYQAVPAGTLGCTSQGPWKETQDSKEAPHCVPVCGRPVT
PITHNQDVLGSSRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSIFPGKNR
SVNVFLGHTNIDEMLKLGNHPVRRVVVHPDYRQNESHNFNGDIALLELQHSVPLGPSLLP
ICLPDSETLYVSGLWGYVSGFGVEMGWLTTELKYSRLPVAPREACKAWLQEKQRTEVFSD
NMFCVGDKMRPQSVCQGDSGGVYVVWDDRTHHWVATGIVSWGIGCGKGYGFYTKVLNYMD
WIKGVMDGKD
Download sequence
Identical sequences XP_005610954.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]