SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005611828.2.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005611828.2.31192
Domain Number 1 Region: 154-307
Classification Level Classification E-value
Superfamily E set domains 3.22e-25
Family Arrestin/Vps26-like 0.03
Further Details:      
 
Domain Number 2 Region: 6-152
Classification Level Classification E-value
Superfamily E set domains 1.19e-20
Family Arrestin/Vps26-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005611828.2.31192
Sequence length 328
Comment PREDICTED: arrestin domain-containing protein 5 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MSVVKSIELLLPKDAIYLAGSSVKGQVVLTLNSTLVNPIVKVELVGRGYVEWKEETGASR
DYSRDVICNNKADYVHKTKTFPVKDNWLSAGSHIFDFHFNLPPRLPSTFSSRTGHVSYFI
QASCMGREHVLAKRRMYLLVQGTSDGHQESPAQNPLLVEAERKVSYNCCSQGTISLQIQM
EKNSFVPGEKVAFTTEINNQTSKCIKTVVVALYGHVQYEGFTPKAERRLRVDSSELLRQE
ANTPIAPFATTKIVGAFNLPLLLSVSGGARDGGIMTTHYELVGTVHLPWSLSSVKVTVPI
IITSAPRDSSSCQLPEAGVVPESPERQN
Download sequence
Identical sequences F6QLL4
9796.ENSECAP00000010649 ENSECAP00000010649 ENSECAP00000010649 XP_005611828.2.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]