SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005611941.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005611941.1.31192
Domain Number 1 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-20
Family KRAB domain (Kruppel-associated box) 0.00049
Further Details:      
 
Domain Number 6 Region: 610-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-19
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 232-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 290-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 10 Region: 568-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 136-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000893
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 79-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000283
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005611941.1.31192
Sequence length 668
Comment PREDICTED: zinc finger protein 709 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MVSVAIEDVAVNFTPEEWALLDPSQKKLYRDVMWETFKNLASIGKTWEVHDIEDWFKNHG
RKQRNHVIERLCESEEGSQCRENFSLLPNLNRNKKTAGAEPCECSACRKVFMHHSCLNRH
IRCHTEHKPYDYQKYGEKVYECQECGKSFTFSSCLRQHERTYTGVKTYKCKKCSKVFTSS
ISLQIHKKVHTREKPHECKICGKVFVSPSTLRSHIMFHNGDQPYTCQVCGKAFTFPSLLQ
LHEKIHTREKSFECKTCGKTFRFSSSFQAHERTHTGEKPYECKKCSKAISYSSSLQVHER
THTGEKPYECKIHGKVFLSPSRLQSHTVFHSGDQPYQCKVCGKAFPFPSRLQKHERTHTG
EKPYECKICGKAFRLSSNVQVHEKIHTGEKPYGCKTCGKVFLRPSSLQSHMMFHNGDQPY
KCKVCGKAFPFPSLLQKHERTHTGEKPYECKKCDKTFSSSSSLQVHERTHTGEKPYECKI
CRKVFLSPSSLRSHTMFHNGDRPYKCKVCGKAFPFPSVLRKHERTHTGEKPYECKICGRA
FRFSSNVQVHKRTHTGEKPYECKICGKVFLSLSSLRSHMMFHNEDQPCKCKVCGKAFPFP
SLLQKHERTHTGEKPYKCKKCSKAFASSNSLRIHERTHTGEKPYECKECGKAFISRRSLQ
KHERSHTG
Download sequence
Identical sequences XP_005611941.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]