SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005611976.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005611976.1.31192
Domain Number 1 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 624-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 568-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 8 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-20
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 9 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 78-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000997
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005611976.1.31192
Sequence length 699
Comment PREDICTED: zinc finger protein 709-like [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MDSVAIEDVAVNFTPEEWALLDPSQKKLYRDVMWETFRHLASVGITWEDCDLQDQYKDQG
RKVRKHRVGRLCESEEDSQCGENFILLSNLSLNKKTTGAKPWGCSACGRVFMHHSSLKTH
IRCHTEHKTYEYQKYGEKPYQCKKCGKAFTYHSLLQRHERTHSGEKPYECKTCSKAFTSS
SCLQRHERIHTGEKPYECNKCSKAFTCSSHLRLHERIHTGEKPYECNKCSKAFTCSSHLR
LHERIHTGEKPYECKKCSKAFTSSSSLQVHERTHTGEKPYECKTCSKAFTSSSCLQKHER
IHTGEKPYECKRCMKAFASSSCLQKHERIHTGEKPYKCRRCIKAFASSSSLQVHERTHTG
EKPYECKTCSKAFTSSSCLQRHERIHTGEKPYECNKCSKAFTCSSHLRLHERIHTGEKPY
ECKKCSKAFASSSSLQLHERTHTGEKPYECKTCSKAFTSSSCLQKHERIHTGEKPYECKR
CIKAFVSSSCLQKHERIHTGEKPYKCKRCIKAFSSSSSLQRHVRTHTGEKPFECKNCSKA
FSYSGSLRIHERTHSGEKPYECKECNKAFTASKYLRVHERRHTGEKPFECKICGKAFIST
SSRSTHERTHTRGKPYECKICNKTFSYSSCLQRHGRTHTGEKPFECKNCSKAFTSSSSLR
IHERTHNGEKPYECKECNKAFTASKYLRVHLRSHTGEKA
Download sequence
Identical sequences XP_005611976.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]