SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005616554.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005616554.1.84170
Domain Number 1 Region: 542-643
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-23
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Weak hits

Sequence:  XP_005616554.1.84170
Domain Number - Region: 222-327,542-562
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family BAR domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005616554.1.84170
Sequence length 648
Comment PREDICTED: pleckstrin homology-like domain family B member 3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MGTPSGPEEGGQPPPVSEGDAEARPQGAAQPHVHPEDPHEPEAPAAPEEPQPVKELPSGR
GAEQQAEEEEEVGEGSSTESSRDAGEAPPPARTPATPPASSPPGEGVRGAARRLREQQLE
ALTRVALMEQRVKELQRQRKELRIEMEVEVALLRGELAGERVAARREEEQLRELLGQQVD
TEQGSHEQREQEQRQLIQERDRVEGLRQRLQEAQGQLDSQPEDQRERLLQGVQEMREQLD
AAQRAYEDLEFQQLEQESRREEEDQDSPGARAGDPKVRELQASVAQHRRRIQVLEEQLKS
LGEQMAAESRGLSQKKEEALQALTQERNRLLELNCLQRTPGRNFSESSQALTKLLITQKT
DRQLLVYQDPTAHTASTTSSCLFSVHSSLQGSIGLQRTGSLPRKRGERASQRGSPRPLSL
HCTGPLGASALPPASGDSGRHPLYQLLNCGPGNSCGSLHPDIARMEQLLQQAVAERERLL
KAREGLRRSKEGSSGPAVPALMAPPSPPPRPPGPRVLDLRQHLERWGHSPESCPHVRVSG
GCCRGSLVKMGGRIKTWKKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLR
CAFKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVVVTAADENHAP
Download sequence
Identical sequences E2RFK8
ENSCAFP00000007093 XP_005616554.1.84170 ENSCAFP00000007093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]