SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005618247.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005618247.2.84170
Domain Number 1 Region: 523-742
Classification Level Classification E-value
Superfamily Bet v1-like 3.16e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 96-244
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-28
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005618247.2.84170
Sequence length 751
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MQRGGGPVPPPLSAPPAAPPCVPGGDPRPAPKGLRSGGGAGRSAGATAAADGWKGRLPSP
LVLLPRSARCQARRRRRGGRTSCPLRPPPAPERALLPSPPPGPSPRLLGASSGAARGAGA
GLPLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNT
LSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDA
IEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDIL
CRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHV
TPRGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKEVEKRRRIEEAY
KNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSEKVRLHWPTSM
PSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVG
GDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWET
TIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSV
DHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASV
LRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_005618247.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]