SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005618564.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005618564.1.84170
Domain Number 1 Region: 12-158
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-24
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 512-584
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000112
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005618564.1.84170
Sequence length 593
Comment PREDICTED: SH3 domain-binding protein 2 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MASLGLRKPAPSPSTDKRRAMCWVSAISFMAAEEMHWPVPMKAIGAQNLLTMPGGVAKAG
YLHKKGGTQLQLLRWPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSN
NVFPFKIVHISKKHRTWFFSASSEDERKSWMALLRKEIGHFHEKKELSLDTSFSDSSSDT
DSFYGAVERPVDISLSSYPTDNEDYEHEDEDDSYMEPDSPEPVEPEDTLTHPPAYPPPPV
PTPRKPAFSDMPRAHSFASKGPSPLLPPPPPKRGLPDASLTSEDSKRDLLGLRRPEAGLR
VSVAPRRMSDPPVGHLPPVPSLRKPPCFHESASPSSEPRVPGHGTGSVSSSASMATTSSR
NCDKLKSFHLSPRGPPTPEPPPVPANKPRFLKMAEEAPSEEVVKPRLFVPSVAPRPPGLK
LPTPEAIAKPAVLPRSEKPPLPYLQRSPPDGQSFRSFSFEKPRRPSKADNAGGEDSDEDY
EKVPLPSSVFINTTESCEVERLFKATSPQGEPQDGLYCIRNSSTKSGKVLVVWDESSNKV
RNYRIFEKDSKFYLEGEVLFVSVGSLVEHYHTHVLPSHQSLLLQRPYGYTRPR
Download sequence
Identical sequences E2RJ40
XP_005618564.1.84170 ENSCAFP00000021844 ENSCAFP00000021844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]