SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005619699.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005619699.1.84170
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-39
Family SCAN domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-17
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000549
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000064
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 7 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000436
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005619699.1.84170
Sequence length 648
Comment PREDICTED: zinc finger protein 202 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEASSP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETIHPGADPESPCELQNPVHTLPPEASREETIQ
SPDLRPPEEQSLCHELEFQPLRESEVPVSQDPDLPEERNAGNPEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPAQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISHVREEEPLVPDI
PEPQEPQEPEILSFTYTGDRSEDEEEYLEQEDLSLEDLHRSILGDPEIHQTPDWEIVFED
DPNRLNERRFGTNISQVNSLSNLQETMPIHPLLGRHHDCPVCGKSFTCNSHLVRHLRTHT
GEKPYKCMECGKSYTRSSHLARHQKVHKMSTPYKFPLNRKNLDKTSPLAQAERTPPVEKP
YRCDDCGKNFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCG
ECGEDFSDHRRYLAHRKTHAAEELYLCSECGRCFNHSAAFAKHLRGHASVRPCRCNECGK
SFSRRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSEKTS
Download sequence
Identical sequences F6XD56
XP_005619697.1.84170 XP_005619699.1.84170 XP_546469.2.84170 ENSCAFP00000016924 ENSCAFP00000016924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]