SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005619719.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005619719.1.84170
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.35e-66
Family Regulator of G-protein signaling, RGS 0.00000793
Further Details:      
 
Domain Number 2 Region: 767-996
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-64
Family DBL homology domain (DH-domain) 0.0000000008
Further Details:      
 
Domain Number 3 Region: 1000-1130
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-39
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005619719.1.84170
Sequence length 1543
Comment PREDICTED: rho guanine nucleotide exchange factor 12 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MSGTQPTITDRFPLKKPIRHGSILNRESPTDKKQKVERSASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTSSKPVGEPLTASEVEADPGEGIGRLDYCTGDAS
RPGSDSADSPKSALKERICLEENPEKSEVIQDTDTQSLFGSPSPRIAAHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVSVPDEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRVTLEKERACAEQIVAKIEEVLMTAQPVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKQRHPKHLSTPSSVSPEPQDPAKLRQSALAGEGTEVGY
LPANPMSSVAAGATLSQEGGKENDTGSKQVGETPASGDCIDNTPRTPNTIFDFPPPPLDQ
VQEEEWEVERVTEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEDKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPMEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSAK
PIPLPQSPPCEGDNDEEAAPKLKVEHHSISVPGLQSPDRDLGLESPLISSKPQSHSLGTS
GKSEVDDLFVAERQFAKEQHTDGTLQEAGGSYQITIPDPHLPASEERWALDALRNLGLLK
QLLVQQLGLTEKSAQEDWPHFPRYRTASSGVQTDSGTQNSENSKAYPPGEGQMPFRTGTG
DISTCYSPRTSTESSAPRDSVVLAFQESQASNILVMDHMIMTPEMPPAEPEGSLDESGEH
FFDAREAHSDDNPSEGDGAVKKEEDVNLRISGNYLILDGYEAVQESSTDEEVASSLPPPP
TAGIPAMDCARPQQHSPQHAHSDGAASPFTPEFLVQQRWGAMEDSCFEIQSPPSCADSQS
QIMEYIRKIEADLEHLKKVEESYSILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences F1PET2
ENSCAFP00000017590 ENSCAFP00000017590 XP_005619719.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]