SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005623946.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005623946.1.84170
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily Cyclin-like 6.81e-30
Family Transcription factor IIB (TFIIB), core domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Cyclin-like 3.71e-16
Family Transcription factor IIB (TFIIB), core domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005623946.1.84170
Sequence length 562
Comment PREDICTED: transcription factor IIIB 90 kDa subunit isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAVSKHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELC
INAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLV
AARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTVDEFMRIDLEGECDPPSYT
AGQRKLRLKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGALATLTRDGSVEDT
TSSLFGEEDPEDEELEAVASHLNKDFYQELLGDSISSSSEVAGGAEGGSRPPALESLLGP
LPTAASLGISDSIRECISSQSQDPTDPCGDGELDLSGIDDLEIDRYILNEAEARVKAELW
MRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQASTAGEAIEKMLEQKKI
SSKINYSVLRDLNSKGGGSVPGEDTRAEERASARKLSRRKTPASRSGADPVTSVGKRLRP
MVSAQPAKKAAVGETVLPSPPALGAEAVRPAAVVESGPVSYHPEEDPDEEDPDEEDGEPC
VSALQMMGSNDYGCDGEEDDGY
Download sequence
Identical sequences J9PB52
ENSCAFP00000043030 XP_005623946.1.84170 XP_005623949.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]