SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005626172.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005626172.1.84170
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 6.77e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.068
Further Details:      
 
Domain Number 2 Region: 175-404,506-632
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000768
Family Armadillo repeat 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005626172.1.84170
Sequence length 820
Comment PREDICTED: serine/threonine-protein phosphatase 4 regulatory subunit 3B isoform X4 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEIPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
ACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLA
KLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVI
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLT
NTSEDKCEKDNIVGSNKNSTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLL
RRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLL
NSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNS
VPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKSKPEDDFPDTYEKFMETK
KAKESEDKENLPKRTSSSGFKFTFSHSASTANGTNSTNSKSVVAQTPPASSNGSSSKTTN
LATSVTATKGSLVGLVDYPDDEEEDEEEETSPRKRPRLGS
Download sequence
Identical sequences E2QYA8
ENSCAFP00000004244 XP_005626172.1.84170 ENSCAFP00000004244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]