SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005626175.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005626175.1.84170
Domain Number 1 Region: 158-268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 301-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 3 Region: 270-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000151
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  XP_005626175.1.84170
Domain Number - Region: 337-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00048
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005626175.1.84170
Sequence length 502
Comment PREDICTED: EGF-containing fibulin-like extracellular matrix protein 1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEGVGAAANAAAASGTGTGTVAASGMATSG
VMPGGGFVASAAAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCATGYEQSEHNVC
QDIDECTAGTHNCRADQVCINLRGSFACQCPQGYQKRGDQCVDIDECTIPPYCHQRCVNT
PGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLN
CEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCW
NYHGGFRCYPRNPCQDPYVLTSENRCVCPVSSAVCRELPQSIVYKYMSIRSDRSVPSDIF
QIQATTIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEMLTVN
SIGTFRTSSVLRLTIIVGPFSF
Download sequence
Identical sequences E2R612
ENSCAFP00000004327 XP_005626175.1.84170 XP_005626176.1.84170 XP_531834.1.84170 9615.ENSCAFP00000004327 ENSCAFP00000004327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]