SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005628710.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005628710.1.84170
Domain Number 1 Region: 14-219
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000057
Further Details:      
 
Domain Number 2 Region: 286-357
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005628710.1.84170
Sequence length 359
Comment PREDICTED: src kinase-associated phosphoprotein 2 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADTLRGENLSKKAKEKRESLIKKIKDVKSTYL
QEFQDKGDAEDGEEYDDPFAGASDTMSLASERYDKDDEAHSEGNQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYNVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMGSDVIPEDDDERGELYDDV
DHPLPTSSPPASSQPTDDEIYEELPEEEEDSAPAKVEEQRKMSQDNVHPTTGDKSTDYAN
FYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Download sequence
Identical sequences F1Q0B6
ENSCAFP00000004328 XP_005628710.1.84170 XP_539483.2.84170 ENSCAFP00000004328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]