SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005629283.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005629283.1.84170
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 2.07e-23
Family Caspase recruitment domain, CARD 0.0000109
Further Details:      
 
Domain Number 2 Region: 109-193
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-20
Family DEATH domain, DD 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005629283.1.84170
Sequence length 199
Comment PREDICTED: death domain-containing protein CRADD isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGVLTENHLQEIKAQATGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLEKAREEAITELPADDWMTGFPPHILNSSPSDRQI
NQLAQRLGPEWEPVVLALGLSQTDIYRCKANHPHNVQSQMVEAFIRWRQRYGKQATFWSL
YRGLQAVEVDPSVLQDMLE
Download sequence
Identical sequences 9615.ENSCAFP00000009280 XP_005629283.1.84170 XP_013975057.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]