SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005629581.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005629581.1.84170
Domain Number 1 Region: 1163-1383
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 1373-1531
Classification Level Classification E-value
Superfamily PH domain-like 6.02e-20
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 1516-1581
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005629581.1.84170
Sequence length 1604
Comment PREDICTED: rho guanine nucleotide exchange factor 5 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MEAEEPQHGALTPIPALAELSIIPEPLRRSSQTATLGPEAQEGWEPSSTWAEGRGLLEPQ
QGGLKDVKSCATESMTSFPEEAPAGVETDQEDTVGDTWDTPERQEPVPQSLADGRARTPA
HAERGACPFQGEHLDTVPVSRERGGGVEMELRPELTSLPGGTGHAEEEEVSPDTSAQPRS
GPPCEEHPAEPELPGDSVKQGEELRAAGAEESPGRGGLMCLLDAWGLEEQGLAEAAFREE
AAAGGDGRLGGQEQGGEQADGTGEQEQKQEQRRGRAMCAKHGERTGLSGELEGLRCSEQG
MEPRRQPGLQQGEEGNRETGGPEEGSGAAQNEEKWSVVGKSGQVTGRPEGRGLRGLRGKV
ASVEGREAEAVGSGEEEPENWDGDPLRGEGREGPTEEGEARDGPSTLALVASEVSSPCDL
FPDTCYPMTGTPGPREEPRAEEPSPVALPPPLESGGWSGRPASLPGSFPAGGSPAQEAAQ
DSQQEGPELGKRAVFGQGTQMVSAGTPATPPRTPHPPPSGPAEVSSRTTTSLSASPPVGS
PRREPFLAAHSPETSRATLRTTHAHHCGASETPPAALPGASSAEATVETPTSSIWAHPQG
PPGHPAGAVQHLRSNSFPGSHRTEPTPDLLGLSLSFSHSELPQRAPKPAIYGSVIPRRDR
KSGRDCRIIPESPSSLSTLGWDSQEFTSNLERSSSPCSTQPCGSPHTSASAPESPAYGSS
PPFISVDGRIPEPLPPPPPEKRHVHPSVVERDSHLHAGVATLKRCGHALPLAPGSGLHGP
PKGPLPPFPDPLVARQHRPLPSTPDTPTPTLTSFSRRLRYNKPLPPTPDLSQPHHSVSFS
NPRIYRPLPPVPIMDPPIEPPPLPPKSKGRSRSTQGELMNSGGRGKPRPVCQERTVSAPH
SVGRTSWPPAMGRSTDSLASTSRSKSEVSPGMAFSNVATLLSPSSPTTHWSLELQGPTCE
PGPSEESEAPARGSLRRSAPPEGANGLRRLDVGQARQSEKLSHPHLEKASSWPHRRDTGR
PLESVSGRVADPGEGSSKHKGWNRQGLRRPSILPEGSSDTRGPGVEKAPGPSDTIVFREK
KPKEVMGGFSRRRSKLINSSQLLYQEYSDVVLNKEIQSQQRLDSLGEATGPASPRQPRKA
LVSSESYLQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEAKFELIVSEASYLRSL
HVAVDHFQLSAPLRATLSNQEYQWLFSRLQDVREVSTTFLSDLEENFESNIFTFQVCDVV
LNHAPDFRRVYLPYVTNQTYQERTFQVLLNSNSSFREVLEKLESDPVCQRLSLKSFLILP
FQRITRLKLLLQNILKRTQPGSPEEAEATKAHHALEELIRDCNNNVQRMRRTEELIYLSQ
KIEFECKIFPLISQSRWLVKSGEVTALEFSLSPGLRRKLNTRPVHLHLFNDCLLLSRPRE
GSRFLVFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLLHNAQGTQAEFLFSTETQSEKLRW
ISALAMPREELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGMRL
SDGERGWFPMQQVEFISNREVRARNVSEAHRVKTAKLQLVEQQT
Download sequence
Identical sequences F1PGP2
ENSCAFP00000005216 ENSCAFP00000005216 XP_005629580.1.84170 XP_005629581.1.84170 XP_539834.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]