SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005630313.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005630313.1.84170
Domain Number 1 Region: 119-179
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000801
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  XP_005630313.1.84170
Domain Number - Region: 184-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0791
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005630313.1.84170
Sequence length 366
Comment PREDICTED: tripartite motif-containing protein 54 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFEALCSVLEERKAELLQALAREQE
EKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGTMSKVELAG
RPEPGYESMEQFTVSVEHVAEMLRTIDFQPGASGEEEDEEVALDGEEGSAGPEEERPDGP
EGTGGH
Download sequence
Identical sequences E2RL94
XP_005630313.1.84170 ENSCAFP00000007243 ENSCAFP00000007243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]