SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005634713.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005634713.1.84170
Domain Number 1 Region: 163-381
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.02e-56
Family DBL homology domain (DH-domain) 0.0000525
Further Details:      
 
Domain Number 2 Region: 371-521
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 529-591
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005634713.1.84170
Sequence length 611
Comment PREDICTED: rho guanine nucleotide exchange factor 26, partial [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
VRASKAPLQNGEPHRRLLKVRSMVEGLRAQDARDEAEPEHDAGSPGSLRRGLRSTSYRRA
VVSGLDLDSPTTSKKKNRMSQPVLRAVMEDKERFSSLGRIKKKMLKGQGTFDGEENAVLY
QNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQLSAVKRNGLSQTVSQEERKR
QEAIFEVISSEHSYLLSLEILIRMFKNSKELGDTMTKTESHHLFSNITDVCEASKKFFTE
LEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRTLQKLLATNPSFKEVLSRI
ESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLC
NEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRRTSKQQ
VYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDSEELNSSPGKNSSTMLYSRQSS
ASHLFTLTVLSNHASEKVEMLLGAETQSERARWITALGRSSGKLPLDRTSLTQVEVVRSF
TAKQPDELSLQVADVVLIYQRVGDGWYEGERLRDGERGWFPMECAKEITCQATIDKNVER
MGRLLGLETNV
Download sequence
Identical sequences F1PGF9
XP_005634713.1.84170 ENSCAFP00000012677 ENSCAFP00000012677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]