SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005634779.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005634779.1.84170
Domain Number 1 Region: 545-786
Classification Level Classification E-value
Superfamily VPS9 domain 4.71e-55
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 93-214
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-17
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 803-884
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000209
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005634779.1.84170
Sequence length 908
Comment PREDICTED: ras and Rab interactor 2 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MSAWTMGARGLDKRGSFFKLIDTIVSEIGELKQEMVQTDVSLENGLEASKSHSMVRHKDD
GYSEEKDMKTCPRDSGYDSLSSRLSILDRLLHTHPIWLQLSLSEEEAAQVLRSQPPGIFL
VRKSTKMQKKVLSLRLPCEFGAPLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRD
VLPFTLKLPYAISTAKTEAQLEELAQLGLNFWSSPADNKPPNPPPPHRPPSSDGVCPASR
QLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLSGGPKRPCTRTPNANGT
ERPRSPPPRPPPPAINSLHTSPQLSRAETPASMPETVNHNKHGNVALLGTKPAPIPPPRL
KKQAFFLDAEGSAKTLTGGRPRPGQERPEPQEPQAPQEPEPEPGPGTAGRPGRAPPAEAP
GDCTRAAGPESRPPWHGGGQRLSDMSLSTSSSDSLEFDRSMPLFGYEADTNSSLEDCEEE
SDQETLAPPIKSKKKRNGSFVLPKLVKSQLRKMSGVFSSFLTPEKRMVRRIAELSRDKCT
YFGCLVQDYVSFLQENKECHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQI
DVVLEKAMHKCILKPLKGHVEAMLRDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPD
FVDVEKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIA
QCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDT
LRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYVTTEDVCQLCAEKFK
VGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGVIFQN
GEEDLTTS
Download sequence
Identical sequences J9NY33
ENSCAFP00000038200 XP_005634779.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]