SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005635377.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005635377.1.84170
Domain Number 1 Region: 508-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000674
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000105
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 740-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000044
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 558-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000339
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 648-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000132
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 601-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000439
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 803-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000942
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  XP_005635377.1.84170
Domain Number - Region: 181-330
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000916
Family Galactoside acetyltransferase-like 0.097
Further Details:      
 
Domain Number - Region: 139-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00609
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005635377.1.84170
Sequence length 929
Comment PREDICTED: zinc finger protein 512B isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MTDPFCVGGGRRLPGSTKSGPGKDGGRNEVRLPVLHDPPKLGMPVVRGGPTVPSQAALCF
DPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAIPERLTFPCPFCEAAFTSKTQLEKHRIWNHMDRPVPAPKPGPVSRP
VTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVTKPVPVSRPVPVTKA
VTVSRPVPVTKPIPVTKSVPVTKPVPVTKPVTLNKPVPVTKSVSVTKPVTVNKPVPMTKL
VTVTKAVPVTKPVTVSRPIVVSKPVTVSRPIAISRHTPPCKMVLLTKSENKTPRTTGRSS
GKKRAADSLDTCPILPKQARPENGEYGSSTTGHSSAFQLSADPGGSPLSLGSRPLGSKEG
LRATGPVSPPDEGAERIKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKSRMHRAKKP
EGPGPEDVRKKVLAPASTVSKEAPAPAAHTAPGGPEEQWQRAIHERGEAVCPTCNVVTRK
TLVGLKKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGSEQEER
ERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRS
KAGHDYHMRSEHTAPPPEEPEDKPPETEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDE
LARDWTKRRVKDDLVPETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIY
SSVSGLKAHLASCSKGDHLVGKYCCLLCPKEFSSESGVKYHILKTHAENWFRTSADPLPK
HRSQDSLAPKKEEKKSLAGGKKRGRKPKERTPEEPAPKMPPRRDDWPPGGRDKGARGSTG
RKAGASKAPEKPKAWGVLGDPRFWADEGT
Download sequence
Identical sequences J9P4W3
ENSCAFP00000019341 ENSCAFP00000040636 XP_005635377.1.84170 XP_005635378.1.84170 XP_013962652.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]