SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005639806.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005639806.1.84170
Domain Number 1 Region: 216-282
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000847
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 285-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000264
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  XP_005639806.1.84170
Domain Number - Region: 58-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0906
Family Chromo barrel domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005639806.1.84170
Sequence length 648
Comment PREDICTED: fragile X mental retardation syndrome-related protein 1 isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
DWSLAGEDDRESRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLL
DNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLDDSEKK
PQRRNRSRRRRFRGQAEDRQPVTVADYISRAESQSRQRNLPRETLAKNKKEMAKDVIEEH
GPSEKAINGPTSASGDEISKLQRTPGEEKINTLKEENTQEAAVLNGVS
Download sequence
Identical sequences M3XTA9
ENSMPUP00000002309 XP_004745131.1.14098 XP_005639806.1.84170 XP_007116495.1.24612 XP_010946134.1.22495 XP_010974532.1.51371 XP_012417117.1.74151 XP_014638644.1.5094 XP_015100200.1.17985 XP_019648467.1.58354 XP_019801701.1.83887 XP_021548299.1.83697 ENSMPUP00000002309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]