SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005640616.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005640616.1.84170
Domain Number 1 Region: 468-530
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-24
Family SH3-domain 0.00039
Further Details:      
 
Weak hits

Sequence:  XP_005640616.1.84170
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0109
Family SNARE fusion complex 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005640616.1.84170
Sequence length 536
Comment PREDICTED: abl interactor 2 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAKLQMLLEEEIPGGHGGLFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS
VAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANLERPVRYIRKPIDYTILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPM
SGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGS
SGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLV
PATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIG
GSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSLAPPPPSILQVTPQLPLMGFVARVQEN
ISDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVV
AIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE
Download sequence
Identical sequences E2RCE3
ENSCAFP00000018916 XP_005640616.1.84170 ENSCAFP00000018916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]