SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005640708.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005640708.1.84170
Domain Number 1 Region: 290-615
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.41e-130
Family Mammalian PLC 0.0000000416
Further Details:      
 
Domain Number 2 Region: 133-289
Classification Level Classification E-value
Superfamily EF-hand 3.17e-47
Family EF-hand modules in multidomain proteins 0.00038
Further Details:      
 
Domain Number 3 Region: 633-758
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-29
Family PLC-like (P variant) 0.0001
Further Details:      
 
Domain Number 4 Region: 11-123
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-25
Family Pleckstrin-homology domain (PH domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005640708.1.84170
Sequence length 767
Comment PREDICTED: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MASLMQSRLPINQDLMLMQKGMLMRKVRSKCWKKLRYFRLQDDGMTVWHARQEGGNAKPT
FSISDVETVREGHESELLRSLAEEFPLERGFTIIFHGRRANLDLVANSVEEAEVWKRGLW
HLMDFVNGMDQQERLDQWLSDWFQRGDKNQDGRMSFQEVQRLLHLMNVEMDQEYAFHLFQ
TADTSHSGTLEGEEFVDFYKALTKRAEVQELFENFSADGQKLTLLEFVDFLREEQKEGER
APDLALELIDRYEPSESGKLRHVLSMDGFLSYLCSKDGDIFKPTCLPIYQDMTQPLNNYY
INSSHNTYLVGDQLYGQSSVEGYIRALKRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPF
KDVVATVAQYAFQTSEYPVILSLENHCSWEQQQVMACHLTEILGEQLLSTTLDGLLPTQL
PSPEELRRKILVKGKKLRTLEEDLEEEEEEELESELEGEQEADPEPEAQLESEPQELSPR
SKDKKKEKKSKPILCPSLSALVVYLKSVSFHSFTHSREHYRFYETSSFSETKAKSLIKEA
GNEFVQHNAWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNVQTAGLEMDICDGLFRQ
NGGCGYVLKPDFLRDAQSSFHPERPVSPFRAQTLLIQVISGQQLPKEDMSKERSIVDPLV
RVEIFGVRPDTTRQETSYVENNGFNPYWGQTLCFRVLVPELALLRFVVKDYNWKSRNDFI
GQYTLPWTCMQQGYRHIHLLSKDGTSLHPASIFVHINIREGLEGDEC
Download sequence
Identical sequences J9NYG9
ENSCAFP00000038338 XP_005640708.1.84170 XP_013966432.1.84170 XP_013966433.1.84170 ENSCAFP00000038338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]