SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005641679.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005641679.1.84170
Domain Number 1 Region: 4-411
Classification Level Classification E-value
Superfamily Serpins 5.89e-117
Family Serpins 0.0000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005641679.1.84170
Sequence length 414
Comment PREDICTED: thyroxine-binding globulin isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MPLFLYLALLVLELHCASSIRSEGKVITCNSPPKNATFYKMSSINADFAFNLYRRFTVET
PDRNIFFSPVSISAALAMLSFGACYSTQIQILESLGFNLTDTPMAEIQQGFQHLICSLNI
PKKELELQMGNTLFIGKQLKPLAQFLDDVKSLYATEVFSTDFSNVSAAQQLINSHVEKQT
KGEVVGLIQDLKPNTIMVLVNYIHFKAQWANPFDPSKTEEGFSFSVDKTTTVKVPMMHQM
EQYYHLVDTELNCTVLQMDYSKNALALFVLPKEGQIEWVEGAMSSKTLKKWNRLLQKGWI
DLFVPKFSISATHDLGATILKMGIQDAFADNANFRGLMGNNGLKFSKAAHKAVLHIGEKG
TEALLVPEVRFLDQPEITLLHPIIQFDRSFLLLILEKSTRSILFLGKVVNPMEV
Download sequence
Identical sequences F1PB85
ENSCAFP00000026397 XP_005641679.1.84170 ENSCAFP00000026397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]