SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005660976.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005660976.1.46622
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-70
Family Nuclear receptor ligand-binding domain 0.000000000625
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005660976.1.46622
Sequence length 447
Comment oxysterols receptor LXR-alpha isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MSLWVEAPVPDVSPDSAVELWESDAQDASSQSLGSSSCILREESSTPQSAGGASRVGLDA
TESTALLPGVEASPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAQATSVPPRASSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDQLRVTPWPM
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q4TU03
ENSSSCP00000014069 NP_001095284.1.46622 XP_005660976.1.46622 XP_013849793.1.46622 XP_013849794.1.46622 XP_013849796.1.46622 XP_020937105.1.46622 XP_020937115.1.46622 9823.ENSSSCP00000014069 ENSSSCP00000014069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]