SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005662065.2.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005662065.2.46622
Domain Number 1 Region: 136-387
Classification Level Classification E-value
Superfamily VPS9 domain 2.75e-88
Family VPS9 domain 0.000000000237
Further Details:      
 
Domain Number 2 Region: 18-69
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000613
Family A20-like zinc finger 0.0000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005662065.2.46622
Sequence length 492
Comment rab5 GDP/GTP exchange factor isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAER
LQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGSKKAEIQE
AKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKMFLESMHYKRDLSIEEQS
ECTQDFYQTVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQ
KRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIF
NAIKVTKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNL
CCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGVKQMYKNLDLLSQ
LNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPPNQSLAAIDSENVENDK
LPPPLQPQVYAG
Download sequence
Identical sequences ENSSSCP00000008261 ENSSSCP00000008261 XP_005662065.2.46622 XP_005662068.1.46622 XP_005662069.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]