SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005740715.1.53837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005740715.1.53837
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily Cupredoxins 3.04e-47
Family Ephrin ectodomain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005740715.1.53837
Sequence length 224
Comment PREDICTED: ephrin-A3-like isoform X1 [Pundamilia nyererei]; AA=GCF_000239375.1; RF=representative genome; TAX=303518; STAX=303518; NAME=Pundamilia nyererei; AL=Scaffold; RT=Major
Sequence
MALATFSLSLITLALTNLHLSRASNRHAVYWNSSNLLLRREGYTVQVSVNDYLDIYCPHY
NTSQRGTLERVVAEQYILYMVDYHGYRTCNTQKGSKRWECNRPHAPHAPIKFSEKFQRYS
AFSLGYEFNVGKEYYYISTPTHHHHGHSCLRLRVFVCCSTVSQADEDSIQTPDYTVRPNI
KIHNIDEFNPEVPKLEKSVSGSSPSRDRLLLTVAMLLVSAVLLS
Download sequence
Identical sequences I3KUN5
XP_004549121.1.88231 XP_005457288.1.78416 XP_005740715.1.53837 XP_005927662.1.24487 XP_006788055.1.46954 ENSONIP00000024831 ENSONIP00000024831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]