SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005749146.1.53837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005749146.1.53837
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.11e-99
Family Sema domain 0.00097
Further Details:      
 
Domain Number 2 Region: 1386-1509,1675-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-35
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000165
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 1041-1125
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000108
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Domain Number 5 Region: 949-1022
Classification Level Classification E-value
Superfamily E set domains 0.00000000014
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 6 Region: 511-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000366
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005749146.1.53837
Sequence length 1899
Comment PREDICTED: plexin-D1 [Pundamilia nyererei]; AA=GCF_000239375.1; RF=representative genome; TAX=303518; STAX=303518; NAME=Pundamilia nyererei; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLGVLALETRRSASALHIQQAFASPNQTNNFVVDPVSRKVYLATVNTIYQ
LNGTLTAEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGIVVACGS
VYQGFCELRKMDNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLSFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKSTGPESR
KLTESYIQMPLQCGFNGNFYNRVLSVYPTEIHAGDGKSPEPYLFGVFSKGDRKSALCAFK
FGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGSACIQKGNLVLQPEQLDCGAAHLQHP
LALQRPLRAIPLLEYPGLSSVSVDNVQNHTVVFLGTSNGRLRKLTLLPNMTTANQWMLKL
RANEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVADCDQWKSCSDCLGAGDAHCGWCTLEN
RCTIQKECAQGLLARSWISMGEGPQQCPSMTLTPAEISISADIKDVGILINGSVPDLIGS
RVECEYEPGVSTVATVHLDSGPSQIQTCPLLPRKSYQPILPGKDHLTVSVAIKVNGTSVV
SGSFIIYDCERTGKIHPKTPCMSCLNTRWKCYWDQNNHLCVSSKDDANQNLLENAASCPS
LVSSEVPPSPSGMVQDFTLSLSNIQENEKLECDFGTEQRYEATWLNSTTVKCSGVTLSTN
QRSQIYHLNLRRRGAFIRHREDVFIDSPQPMKVEVYNCGVGSSDCSQCWGREDKGHLCGW
CDSICKPRDECQPIRDQCPNPEIHEISPLSGPVEGGTLLTVQGRNLGRRAKAVRVSIGDV
NCTLLPQFYTVSTELVCVTGRAADNRSDIVQVDVEQSGMGKSKETFSYLIPKLLSMEPER
GLRAGGTKVTINGEHLNIGSEVKVNVNTTQECIITKKTARTIECIMPPASQAHTDPVTVC
VEFENKTCEGPELSTTYTYERNPTITSIHPKMSFRSGGRNITVTGQGFDLVQSVTMQVVG
IGHSQCEVLTPSTIACRSPPSNQSQPTSVQFLLNGVLYTNDRPFSSDTDDEEEEEEPHIG
HFPLEYVEDPQFFTANKEKLIKHHSGEQLTLIINKVPSDLELMPEEYSVMIGSYPCNITF
HNDQLFHCTINGLSSSSERELPVFVQVGNFRRKVATVQLGGSEMAIVVSIVVCCVLLLLC
TVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGI
PFLEYKQFVTRTFFPKMCSDYEKSLVQPVYENDALGPRALPETHPLLQDWQATNTTRPNI
EEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEK
IIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPE
GASLAMSMQDKKENTLGRVKDLDTEKYVHLVLPHDELMENKRSHRQSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQCYYQQIQDMPPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRN
QVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_005749146.1.53837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]