SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005795707.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005795707.1.87360
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.02e-27
Family Hormone receptor domain 0.00034
Further Details:      
 
Domain Number 2 Region: 124-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000183
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005795707.1.87360
Sequence length 414
Comment PREDICTED: growth hormone-releasing hormone receptor [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MFRPDTRGIFLSLCLARVALSLLHPECEFYFQLEKEERLCLQYIAEQENRSTEGCRPLWD
EVVCWPQAVTGETVQRGCPAVFSLFRNNTGSVSRNCTSRGWSKAFPAYHIACTVDDDIPE
TEQSYFATVKLIYTIGYSISLGVLAVAVFILLMFRRLRCARNFIHIQLFLSFILKSVAVF
IKDANLFPSYDTNHCTLSTFACKASVVFCHYCMITNFFWLLVEALYLNSLLLSSFYHSRR
CLWGLSILGWGVPVVFILLWIGSRVYFEDTECWDNTKDSPYWWIIQGPIVVSIAVNFMLF
VNIIRILIQKLNPRLIQFNNSSQYRRLAKSTLLLIPLFGTHYMFSSFLPDYLNNLRFYIE
LCLGSFQGLLVAVLYCFLNQEVQKEVHMQWLRWQERSYGVVSPAAKGSQMDTPF
Download sequence
Identical sequences M4AFK8
ENSXMAP00000013252 XP_005795707.1.87360 ENSXMAP00000013252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]