SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005796338.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005796338.1.87360
Domain Number 1 Region: 180-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-55
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 40-144
Classification Level Classification E-value
Superfamily POZ domain 1.1e-31
Family Tetramerization domain of potassium channels 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005796338.1.87360
Sequence length 622
Comment PREDICTED: potassium voltage-gated channel subfamily D member 2-like isoform X1 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MAAGVAAWLPFARAAAIGWMPVASTPMPIPPQDKRKAQDGLIILNVSGTKFQTWRTTLER
YPDTLLGSTERDFFFHEETSEYFFDRDPDIFRHILNFYRTGKLHYPRQECISAYDEELAF
FGIIPEIIGDCCYEEYKDRRRENAERLQDDEEMDMNNDVTPVNLTFREYLWRAFENPHTS
TLALVFYYVTGFFIAISVMANVVETVPCGTLPNRSKEMSCGDRYALAFFCLDTACVMIFT
VEYLLRLIAAPSRCKFMKSVMSVIDVVAIMPYYIGLVMTDNDQVSGAFVTLRVFRVFRIF
KFSRHSAGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSTATKFTSIPAAF
WYTIVTMTTLGYGDMVPKTIVGKVFGSICSLSGVLVIALPVPVIVSNFSRIYHQSQRAEK
RRAQRKTRLARIRAAKIRGTNAYMRYKQNGLLIDALEEASKEAGQALVGKAASPPFESQH
HHLLHCLEKTTNHEFVDEQTFQANCMEISVVNKSGSRTSSLSSSPHGLSSCCSRRHRKKS
SFSLPSTNNQELSTIQIRERPVSNSRSSLNAKLDETMPLKCDEAYISPSMVRLSAPVATS
SDDASTATTTYSQSNIVRVSAL
Download sequence
Identical sequences M4AQ06
ENSXMAP00000016551 XP_005796338.1.87360 ENSXMAP00000016551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]