SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005798205.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005798205.1.87360
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-29
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 125-421
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000549
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005798205.1.87360
Sequence length 478
Comment PREDICTED: calcitonin gene-related peptide type 1 receptor [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MAERKLDGFRWSWKVALILLCNLTTFLVRASMEVNESQQQHPNNVYHDFGITRNKIVTAQ
FECYQRIMKDNTNGRHEPMCNRTWDGWLCWDDTQPGVTSEQHCPDYFQDFDPSEMVTKIC
TNNGQWFVHPDSNRTWTNYTRCNEHTNEGMVTAMNHFYLTLIGHGLSLVSLFISLAIFFH
FKSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNRELVQRNPMSCKVSQFIHLYLFGC
NYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPASIHAIARSYYYNDNCWIS
SKTSLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLL
GIEFVLLPYKPEGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQHHIQ
FGSSIGNHSDALRSASYTASSIIEVQGCYSIDGHTEHMNGKSFHDTDVSVLKSDSTFA
Download sequence
Identical sequences M3ZY64
ENSXMAP00000007158 XP_005798205.1.87360 ENSXMAP00000007158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]