SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005801963.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005801963.1.87360
Domain Number 1 Region: 111-199
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-23
Family Thyroglobulin type-1 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 58-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-16
Family Growth factor receptor domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005801963.1.87360
Sequence length 201
Comment PREDICTED: insulin-like growth factor-binding protein 6 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MPLLSNLTAVVLLLIAHCGSWAGGSRWGPFKVCPSCKDPLGVGRPPRDHDVAGSTTVLAQ
GEPCGVYTLSCAKGLRCMPPPREHSPLQALLQGRGVCAKHIRTSPTERPHPTGPHPSHFG
DLEKAPCRKLLNSVLRGLELTIFQSDRDIYIPNCDTRGFYRKKQCRSSKGMQRGHCWCVD
ELGAPVPSRAREDGTLPCDGE
Download sequence
Identical sequences M4A4Z9
ENSXMAP00000009543 ENSXMAP00000009543 XP_005801963.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]