SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005802925.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005802925.1.87360
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.96e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0015
Further Details:      
 
Domain Number 2 Region: 443-505
Classification Level Classification E-value
Superfamily F-box domain 0.000000567
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005802925.1.87360
Sequence length 639
Comment PREDICTED: transcription elongation factor B polypeptide 3 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MADQLLETVERLQSRIQDNPEPRKLLKTLKRLGEVQMTVDILVRTGVGKTVNSFRKHDYA
GELAKSLVAKWKKLVPQTADRPNSHPKPAPQSHHRSYTEPSPEEQRSYVEEEEDEEVEEE
EEMVYHSNYSPSPPQQQQYSPPQRSGYESEEYEPEPSPPPLPPPPLPPPRKEIRHSKPSK
NHHHRDEERWQAGSDRGGGKKRSADRERTNSPPPQKKHSRKSTPHDTKKEEKKKGGEDGR
PRPPKDPPPSKEDDDDFEAHTMSFESFLTYDAPTPVKKKKKQQPSSSSHSRPSQSSSGSS
SRQNRTAASSSSSSSSSSKANKANGSQSSKRSHSDSKSSEPKPEKRKRVVEALPTLPDIP
LPAIQPNYRPLPSIDTPLSPQRRKVPVCNDEEDAGFTGKRFNSKMVVYSGSKTSYLPRMM
TLYEQCIRVLQNNIDSIAEVGGVPFEILEPVLERCTPEQLYRIEQSNQCFTEDSDELWMR
HCRRDFKRESPQEFESWREMYLRLHDEREERLRLLTQNISSAHANKPKGRQVKMAFVNSV
AKPPRDVRRRQEKFGTSSSSSSTSTAAASPIKIKPASSDFAGDSSHSSSHFSSPAGSSRS
SAPPGGGTVHPGREKPQVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences M4API7
XP_005802925.1.87360 ENSXMAP00000016382 ENSXMAP00000016382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]