SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005804049.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005804049.1.87360
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily PH domain-like 9.95e-48
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000589
Further Details:      
 
Weak hits

Sequence:  XP_005804049.1.87360
Domain Number - Region: 208-287
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.00141
Family Tubulin chaperone cofactor A 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005804049.1.87360
Sequence length 358
Comment PREDICTED: homer protein homolog 1-like isoform X2 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MGEQPIYSTRAHVFQIDPNTKKNWLPASKHAVTVSYFYDSTRNVYRIISLDGTKAIINST
ISPNMTFTKTSQKFGQWADSRANTVYGLGFSTEHHLSKFAEKFAEYKEAARLAKEKSQEK
MEMATSPSQESPAGELASPLTPLTPPMENINGTDEICDTTPNSDSRPEPAQNALAFAHSP
AMTKHWEAELEALKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECQSN
QTPVIKSQKTELNQTIEELENVLRDKEEEMEKLKEELENMNDLMEQKDTLTQKLEETELR
SRVLEEQLAGAEQRLEENQEEQENFRKSLRTLLELLDGKIFELTELRDTLARLIEEAS
Download sequence
Identical sequences M3ZYC8
ENSXMAP00000007222 XP_005804049.1.87360 ENSXMAP00000007222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]